General Information

  • ID:  hor002128
  • Uniprot ID:  P33717
  • Protein name:  Insulin-like growth factor II
  • Gene name:  IGF2
  • Organism:  Gallus gallus (Chicken)
  • Family:  Insulin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Gallus (genus), Phasianinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005159 insulin-like growth factor receptor binding; GO:0005178 integrin binding; GO:0005179 hormone activity; GO:0008083 growth factor activity; GO:0043539 protein serine/threonine kinase activator activity
  • GO BP:  GO:0007165 signal transduction; GO:0008284 positive regulation of cell population proliferation; GO:0042104 positive regulation of activated T cell proliferation; GO:0043410 positive regulation of MAPK cascade; GO:0045944 positive regulation of transcription by RNA polymerase II; GO:0046628 positive regulation of insulin receptor signaling pathway; GO:0050731 positive regulation of peptidyl-tyrosine phosphorylation; GO:0051147 regulation of muscle cell differentiation; GO:0051148 negative regulation of muscle cell differentiation; GO:0051781 positive regulation of cell division; GO:1905564 positive regulation of vascular endothelial cell proliferation
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  AYGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSE
  • Length:  68
  • Propeptide:  MCAARQILLLLLAFLAYALDSAAAYGTAETLCGGELVDTLQFVCGDRGFYFSRPVGRNNRRINRGIVEECCFRSCDLALLETYCAKSVKSERDLSATSLAGLPALNKESFQKPSHAKYSKYNVWQKKSSQRLQREVPGILRARRYRWQAEGLQAAEEARAMHRPLISLPSQRPPAPRASPEATGPQE
  • Signal peptide:  MCAARQILLLLLAFLAYALDSAA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  9-48; 21-61; 47-52
  • Structure ID:  AF-P33717-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor002128_AF2.pdbhor002128_ESM.pdb

Physical Information

Mass: 878486 Formula: C326H515N95O102S6
Absent amino acids: HMW Common amino acids: GRCEL
pI: 6.34 Basic residues: 9
Polar residues: 27 Hydrophobic residues: 21
Hydrophobicity: -18.97 Boman Index: -13934
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 73.09
Instability Index: 5125.74 Extinction Coefficient cystines: 4845
Absorbance 280nm: 72.31

Literature

  • PubMed ID:  1688912
  • Title:  Chemical and Biological Characterization of Chicken Insulin-Like Growth factor-II.
  • PubMed ID:  3379351
  • Title:  Purification, Partial Sequences and Properties of Chicken Insulin-Like Growth Factors